Isolation and characterization of a diuretic peptide common to the house fly and stable fly

F L Clottens; G M Holman; G M Coast; N F Totty; T K Hayes; I Kay; A I Mallet; M S Wright; J S Chung; O Truong

doi:10.1016/0196-9781(94)90059-0

Isolation and characterization of a diuretic peptide common to the house fly and stable fly

Peptides. 1994;15(6):971-9. doi: 10.1016/0196-9781(94)90059-0.

Authors

F L Clottens¹, G M Holman, G M Coast, N F Totty, T K Hayes, I Kay, A I Mallet, M S Wright, J S Chung, O Truong, et al.

Affiliation

¹ Food Animal Protection Research Laboratory, U.S. Department of Agriculture, College Station, TX 77845.

PMID: 7991460
DOI: 10.1016/0196-9781(94)90059-0

Abstract

An identical CRF-related diuretic peptide (Musca-DP) was isolated and characterized from whole-body extracts of the house fly, Musca domestica, and stable fly, Stomoxys calcitrans. The peptide stimulates cyclic AMP production in Manduca sexta Malpighian tubules and increases the rate of fluid secretion by isolated Musca domestica tubules. The 44-residue peptide, with a mol.wt. of 5180, is amidated, and has the primary structure: NKPSLSIVNPLDVLRQRLLLEIARRQMKENTRQVELNRAILKNV-NH2. Musca-DP has a high percentage of sequence identity with other characterized CRF-related insect diuretic peptides.

Publication types

Comparative Study
Research Support, Non-U.S. Gov't

MeSH terms

Amino Acid Sequence
Animals
Corticotropin-Releasing Hormone / analogs & derivatives*
Cyclic AMP / metabolism
Diuretics / chemistry*
Diuretics / isolation & purification
Diuretics / pharmacology
Houseflies / chemistry
Malpighian Tubules / drug effects
Manduca / drug effects
Mass Spectrometry
Molecular Sequence Data
Muscidae / chemistry*
Peptides / chemistry*
Peptides / isolation & purification
Peptides / pharmacology
Sequence Analysis
Sequence Homology, Amino Acid

Substances

Diuretics
Peptides
Corticotropin-Releasing Hormone
Cyclic AMP