Isolation and characterization of CRF-related diuretic hormones from the whitelined sphinx moth Hyles lineata

Insect Biochem Mol Biol. 2000 Feb;30(2):127-33. doi: 10.1016/s0965-1748(99)00106-x.


We have isolated and characterized two diuretic hormones (DH), Hylli-DH41 and Hylli-DH30, from extracts of whole heads of the lepidopteran Hyles lineata. We monitored the isolation by measuring the ability of fractions to affect levels of cyclic AMP production by Malpighian tubules of Manduca sexta maintained in vitro. These DH are related to a family of vertebrate neuropeptides which includes sauvagine, corticotropin-releasing factor (CRF), and urotensin I. Both Hylli-DH41 (RMPSLSIDLPMSVLRQKLSLE KERKVQALRAAANRNFLNDI-NH2) and Hylli-DH30 (SFSVNPAVEILQHRYMEKVAQNNRNFLNRV-NH2) show extremely high similarity with two DH from the tobacco hornworm M. sexta. This is not surprising because both H. lineata and M. sexta are sphingid moths. The discovery of these DH provides a third example of two CRF-related DH occurring in one insect species.

Publication types

  • Comparative Study
  • Research Support, U.S. Gov't, Non-P.H.S.
  • Research Support, U.S. Gov't, P.H.S.

MeSH terms

  • Amino Acid Sequence
  • Animals
  • Corticotropin-Releasing Hormone / genetics
  • Cyclic AMP / biosynthesis
  • Diuresis
  • Insect Hormones / genetics
  • Insect Hormones / isolation & purification*
  • Insect Hormones / metabolism
  • Manduca / genetics
  • Manduca / metabolism
  • Molecular Sequence Data
  • Moths / genetics
  • Moths / metabolism*
  • Sequence Homology, Amino Acid
  • Species Specificity


  • Insect Hormones
  • Corticotropin-Releasing Hormone
  • Cyclic AMP

Associated data

  • SWISSPROT/P82014
  • SWISSPROT/P82015