Skip to main page content
U.S. flag

An official website of the United States government

Dot gov

The .gov means it’s official.
Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you’re on a federal government site.

Https

The site is secure.
The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.

Access keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation

Search Page

My NCBI Filters
Results by year

Table representation of search results timeline featuring number of search results per year.

Year Number of Results
1967 1
1970 1
1983 1
1984 1
1986 1
1988 4
1989 2
1990 4
1991 1
1992 4
1993 3
1994 2
1995 1
1996 3
1997 5
1998 2
1999 6
2000 3
2001 5
2002 8
2003 9
2004 7
2005 8
2006 11
2007 10
2008 14
2009 18
2010 13
2011 5
2012 18
2013 21
2014 19
2015 18
2016 23
2017 26
2018 24
2019 25
2020 37
2021 43
2022 38
Text availability
Article attribute
Article type
Publication date

Search Results

395 results
Results by year
Filters applied: . Clear all The following terms were ignored: %, %, %, % The following terms were not found in PubMed: 22Androulakis, 5BAuthor
Page 1
The impact of individual Cognitive Stimulation Therapy (iCST) on cognition, quality of life, caregiver health, and family relationships in dementia: A randomised controlled trial.
Orrell M, Yates L, Leung P, Kang S, Hoare Z, Whitaker C, Burns A, Knapp M, Leroi I, Moniz-Cook E, Pearson S, Simpson S, Spector A, Roberts S, Russell I, de Waal H, Woods RT, Orgeta V. Orrell M, et al. PLoS Med. 2017 Mar 28;14(3):e1002269. doi: 10.1371/journal.pmed.1002269. eCollection 2017 Mar. PLoS Med. 2017. PMID: 28350796 Free PMC article. Clinical Trial.
Secondary outcomes included quality of the caregiving relationship from the perspectives of the person and of the caregiver (Quality of the Carer Patient Relationship Scale) and health-related QoL (European Quality of Life-5 Dimensions [EQ-5D]) for the caregiver. Intention …
Secondary outcomes included quality of the caregiving relationship from the perspectives of the person and of the caregiver (Quality of the …
Chiral Resolution of Spin-Crossover Active Iron(II) [2x2] Grid Complexes.
Suryadevara N, Pausch A, Moreno-Pineda E, Mizuno A, Bürck J, Baksi A, Hochdörffer T, Šalitroš I, Ulrich AS, Kappes MM, Schünemann V, Klopper W, Ruben M. Suryadevara N, et al. Chemistry. 2021 Nov 2;27(61):15171-15179. doi: 10.1002/chem.202101432. Epub 2021 Jul 20. Chemistry. 2021. PMID: 34165834 Free PMC article.
The complexation of these chiral ligands with Fe(II) salt resulted in the formation of enantiomerically pure Fe(II) grid complexes, as unambiguously elucidated by CD and XRD studies. ...The good agreement between the experimentally obtained and calculated CD spectra …
The complexation of these chiral ligands with Fe(II) salt resulted in the formation of enantiomerically pure Fe(II) grid compl …
Microbubbles conjugated with knottin 2.5D.
Leung K. Leung K. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. PMID: 21204315 Free Books & Documents. Review.
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2.5D (with three disulfide bonds; GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCG-NH(2)) was identified from a series of genetically engineered k …
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knotti …
Biochemistry of iodothyronine deiodination.
Köhrle J. Köhrle J. Acta Med Austriaca. 1988;15 Suppl 1:22-4. Acta Med Austriaca. 1988. PMID: 3051830 Review.
The purification to homogeneity and cloning of the substrate binding 27kDa subunit of 5'-deiodinase type I is currently performed and these experiments suggest a close similarity of this subunit in 5'D I and II, no evidence is found yet supporting a structural relationship …
The purification to homogeneity and cloning of the substrate binding 27kDa subunit of 5'-deiodinase type I is currently performed and these …
Health-Related Quality of Life Among Patients With HR+/HER2- Early Breast Cancer.
Criscitiello C, Spurden D, Piercy J, Rider A, Williams R, Mitra D, Wild R, Corsaro M, Kurosky SK, Law EH. Criscitiello C, et al. Clin Ther. 2021 Jul;43(7):1228-1244.e4. doi: 10.1016/j.clinthera.2021.04.020. Epub 2021 Jul 11. Clin Ther. 2021. PMID: 34256965
FINDINGS: Overall, 1110 patients completed the HRQOL questionnaires (mean age, 59 years; 79% active adjuvant treatment, and 21% under surveillance postadjuvant treatment at time of questionnaire administration; 31% stage I, 48% stage II, and 20% stage III at diagnosis). Of …
FINDINGS: Overall, 1110 patients completed the HRQOL questionnaires (mean age, 59 years; 79% active adjuvant treatment, and 21% under survei …
Outcomes among critically ill adults with influenza infection.
Aziza E, Slemko J, Zapernick L, Smith SW, Lee N, Sligl WI. Aziza E, et al. J Assoc Med Microbiol Infect Dis Can. 2021 Dec 3;6(4):269-277. doi: 10.3138/jammi-2021-0011. eCollection 2021 Dec. J Assoc Med Microbiol Infect Dis Can. 2021. PMID: 36338460 Free PMC article.
RESULTS: ne hundred thirty patients with confirmed influenza infection had a mean age of 56 (SD 16) years; 72 (55%) were male. Mean Acute Physiology and Chronic Health Evaluation (APACHE II) score was 22 (SD 9). One hundred eight (83%) patients had influenza A (46% …
RESULTS: ne hundred thirty patients with confirmed influenza infection had a mean age of 56 (SD 16) years; 72 (55%) were male. Mean Acute Ph …
Evaluating electrochemical accessibility of 4fn5d1 and 4fn+1 Ln(II) ions in (C5H4SiMe3)3Ln and (C5Me4H)3Ln complexes.
Trinh MT, Wedal JC, Evans WJ. Trinh MT, et al. Dalton Trans. 2021 Oct 19;50(40):14384-14389. doi: 10.1039/d1dt02427b. Dalton Trans. 2021. PMID: 34569559
Fc(+)/Fc) for a series of Cp'(3)Ln complexes (Cp' = C(5)H(4)SiMe(3), Ln = lanthanide) were determined via electrochemistry in THF with [(n)Bu(4)N][BPh(4)] as the supporting electrolyte. The Ln(III)/Ln(II) reduction potentials for Ln = Eu, Yb, Sm, and Tm (-1.07 to -2.83 V) …
Fc(+)/Fc) for a series of Cp'(3)Ln complexes (Cp' = C(5)H(4)SiMe(3), Ln = lanthanide) were determined via electrochemistry in THF with [(n)B …
Responsiveness of the EuroQoL 5-Dimension (EQ-5D) questionnaire in patients with spondyloarthritis.
Tsang HHL, Wong CKH, Cheung PWH, Lau CS, Chung HY, Cheung JPY. Tsang HHL, et al. BMC Musculoskelet Disord. 2021 May 14;22(1):439. doi: 10.1186/s12891-021-04315-4. BMC Musculoskelet Disord. 2021. PMID: 33990193 Free PMC article.
EQ-5D scores also correlated well with HADS. The GRC was not able to discriminate adequately. ...LEVEL OF EVIDENCE: II....
EQ-5D scores also correlated well with HADS. The GRC was not able to discriminate adequately. ...LEVEL OF EVIDENCE: II....
Understanding the Stabilization and Tunability of Divalent Europium 2.2.2B Cryptates.
Poe TN, Beltrán-Leiva MJ, Celis-Barros C, Nelson WL, Sperling JM, Baumbach RE, Ramanantoanina H, Speldrich M, Albrecht-Schönzart TE. Poe TN, et al. Inorg Chem. 2021 Jun 7;60(11):7815-7826. doi: 10.1021/acs.inorgchem.1c00300. Epub 2021 May 14. Inorg Chem. 2021. PMID: 33990139
While both crystals exhibit the typical blue emission observed in most Eu(II) containing compounds as a result of 4f(6)5d(1) to 4f(7) transitions, computational results show that the substitution of a Cl(-) anion in the place of a methanol molecule causes mixing of …
While both crystals exhibit the typical blue emission observed in most Eu(II) containing compounds as a result of 4f(6)5d(1) t …
Structure and reactivity of a mononuclear gold(II) complex.
Preiß S, Förster C, Otto S, Bauer M, Müller P, Hinderberger D, Hashemi Haeri H, Carella L, Heinze K. Preiß S, et al. Nat Chem. 2017 Aug 7;9(12):1249-1255. doi: 10.1038/nchem.2836. Nat Chem. 2017. PMID: 29168491
Mononuclear gold(II) complexes are very rare labile species. Transient gold(II) species have been suggested in homogeneous catalysis and in medical applications, but their geometric and electronic structures have remained essentially unexplored: even fundamental dat …
Mononuclear gold(II) complexes are very rare labile species. Transient gold(II) species have been suggested in homogeneous cat …
395 results