Skip to main page content
U.S. flag

An official website of the United States government

Dot gov

The .gov means it’s official.
Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you’re on a federal government site.

Https

The site is secure.
The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.

Access keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation

Search Page

My NCBI Filters
Results by year

Table representation of search results timeline featuring number of search results per year.

Year Number of Results
1967 1
1970 1
1983 1
1984 1
1986 1
1988 4
1989 2
1990 4
1991 1
1992 4
1993 3
1994 2
1995 1
1996 3
1997 5
1998 2
1999 6
2000 3
2001 5
2002 8
2003 9
2004 7
2005 8
2006 11
2007 10
2008 14
2009 18
2010 13
2011 5
2012 18
2013 21
2014 19
2015 18
2016 23
2017 26
2018 24
2019 25
2020 37
2021 43
2022 40
2023 7
Text availability
Article attribute
Article type
Publication date

Search Results

402 results
Results by year
Filters applied: . Clear all The following terms were ignored: %, %, %, % The following terms were not found in PubMed: 22Androulakis, 5BAuthor
Page 1
The impact of individual Cognitive Stimulation Therapy (iCST) on cognition, quality of life, caregiver health, and family relationships in dementia: A randomised controlled trial.
Orrell M, Yates L, Leung P, Kang S, Hoare Z, Whitaker C, Burns A, Knapp M, Leroi I, Moniz-Cook E, Pearson S, Simpson S, Spector A, Roberts S, Russell I, de Waal H, Woods RT, Orgeta V. Orrell M, et al. PLoS Med. 2017 Mar 28;14(3):e1002269. doi: 10.1371/journal.pmed.1002269. eCollection 2017 Mar. PLoS Med. 2017. PMID: 28350796 Free PMC article. Clinical Trial.
Secondary outcomes included quality of the caregiving relationship from the perspectives of the person and of the caregiver (Quality of the Carer Patient Relationship Scale) and health-related QoL (European Quality of Life-5 Dimensions [EQ-5D]) for the caregiver. Intention …
Secondary outcomes included quality of the caregiving relationship from the perspectives of the person and of the caregiver (Quality of the …
Efficacy and Safety of Difelikefalin in Japanese Patients With Moderate to Severe Pruritus Receiving Hemodialysis: A Randomized Clinical Trial.
Narita I, Tsubakihara Y, Uchiyama T, Okamura S, Oya N, Takahashi N, Gejyo F; MR13A9-4 Trial Investigators. Narita I, et al. JAMA Netw Open. 2022 May 2;5(5):e2210339. doi: 10.1001/jamanetworkopen.2022.10339. JAMA Netw Open. 2022. PMID: 35511180 Free PMC article. Clinical Trial.
DESIGN, SETTING, AND PARTICIPANTS: This randomized, double-blind, placebo-controlled, 4-arm phase 2 trial was conducted from February 1, 2019, to October 22, 2019, at 94 sites in Japan. Patients with moderate to severe pruritus receiving hemodialysis were enrolled. ...The …
DESIGN, SETTING, AND PARTICIPANTS: This randomized, double-blind, placebo-controlled, 4-arm phase 2 trial was conducted from February 1, 201 …
Microbubbles conjugated with knottin 2.5D.
Leung K. Leung K. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. PMID: 21204315 Free Books & Documents. Review.
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2.5D (with three disulfide bonds; GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCG-NH(2)) was identified from a series of genetically engineered k …
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knotti …
Anion-assisted supramolecular assemblies of zinc(II) complexes with isonicotinamide.
Soldin Ž, Kukovec BM, Debač T, Đaković M, Popović Z. Soldin Ž, et al. Heliyon. 2022 Jul 16;8(7):e09943. doi: 10.1016/j.heliyon.2022.e09943. eCollection 2022 Jul. Heliyon. 2022. PMID: 35880001 Free PMC article.
Five zinc(II) coordination compounds, [ZnCl(2)(isn)(2)] (1), [ZnBr(2)(isn)(2)] (2), [Zn(NO(3))(2)(H(2)O)(isn)(2)] (3), [Zn(CH(3)COO)(2)(isn)](2) (4) and [Zn(isn)(4)(H(2)O)(2)](ClO(4))(2) (5) (isn = isonicotinamide), were prepared by the reactions of the isonicotinamide (py …
Five zinc(II) coordination compounds, [ZnCl(2)(isn)(2)] (1), [ZnBr(2)(isn)(2)] (2), [Zn(NO(3))(2)(H(2)O)(isn)(2)] (3), [Zn(CH(3)COO)( …
Biochemistry of iodothyronine deiodination.
Köhrle J. Köhrle J. Acta Med Austriaca. 1988;15 Suppl 1:22-4. Acta Med Austriaca. 1988. PMID: 3051830 Review.
The purification to homogeneity and cloning of the substrate binding 27kDa subunit of 5'-deiodinase type I is currently performed and these experiments suggest a close similarity of this subunit in 5'D I and II, no evidence is found yet supporting a structural relationship …
The purification to homogeneity and cloning of the substrate binding 27kDa subunit of 5'-deiodinase type I is currently performed and these …
Digit ratios and their asymmetries as risk factors of developmental instability and hospitalization for COVID-19.
Kasielska-Trojan A, Manning JT, Jabłkowski M, Białkowska-Warzecha J, Hirschberg AL, Antoszewski B. Kasielska-Trojan A, et al. Sci Rep. 2022 Mar 17;12(1):4573. doi: 10.1038/s41598-022-08646-7. Sci Rep. 2022. PMID: 35301404 Free PMC article.
Here we consider whether markers for prenatal sex hormones and postnatal stressors on developmental instability, i.e. digit ratios and their directional and unsigned asymmetries, are predictive of hospitalization. We focus on six ratios: 2D:3D; 2D:4D; 2D:5D; 3D:4D; 3D:5
Here we consider whether markers for prenatal sex hormones and postnatal stressors on developmental instability, i.e. digit ratios and their …
Patient-reported outcomes with olaparib plus abiraterone versus placebo plus abiraterone for metastatic castration-resistant prostate cancer: a randomised, double-blind, phase 2 trial.
Saad F, Thiery-Vuillemin A, Wiechno P, Alekseev B, Sala N, Jones R, Kocak I, Chiuri VE, Jassem J, Fléchon A, Redfern C, Kang J, Burgents J, Gresty C, Degboe A, Clarke NW. Saad F, et al. Lancet Oncol. 2022 Oct;23(10):1297-1307. doi: 10.1016/S1470-2045(22)00498-3. Epub 2022 Sep 2. Lancet Oncol. 2022. PMID: 36063830 Clinical Trial.
Patients were asked to complete the Brief Pain Inventory-Short Form (BPI-SF), single-item worst bone pain, Functional Assessment of Cancer Therapy-Prostate (FACT-P) questionnaire, and EuroQol-5 five-dimension five level (EQ-5D-5L) assessment at baseline, at weeks 4, 8, and …
Patients were asked to complete the Brief Pain Inventory-Short Form (BPI-SF), single-item worst bone pain, Functional Assessment of Cancer T …
Chiral Resolution of Spin-Crossover Active Iron(II) [2x2] Grid Complexes.
Suryadevara N, Pausch A, Moreno-Pineda E, Mizuno A, Bürck J, Baksi A, Hochdörffer T, Šalitroš I, Ulrich AS, Kappes MM, Schünemann V, Klopper W, Ruben M. Suryadevara N, et al. Chemistry. 2021 Nov 2;27(61):15171-15179. doi: 10.1002/chem.202101432. Epub 2021 Jul 20. Chemistry. 2021. PMID: 34165834 Free PMC article.
The complexation of these chiral ligands with Fe(II) salt resulted in the formation of enantiomerically pure Fe(II) grid complexes, as unambiguously elucidated by CD and XRD studies. ...The good agreement between the experimentally obtained and calculated CD spectra …
The complexation of these chiral ligands with Fe(II) salt resulted in the formation of enantiomerically pure Fe(II) grid compl …
Outcomes among critically ill adults with influenza infection.
Aziza E, Slemko J, Zapernick L, Smith SW, Lee N, Sligl WI. Aziza E, et al. J Assoc Med Microbiol Infect Dis Can. 2021 Dec 3;6(4):269-277. doi: 10.3138/jammi-2021-0011. eCollection 2021 Dec. J Assoc Med Microbiol Infect Dis Can. 2021. PMID: 36338460 Free PMC article.
RESULTS: ne hundred thirty patients with confirmed influenza infection had a mean age of 56 (SD 16) years; 72 (55%) were male. Mean Acute Physiology and Chronic Health Evaluation (APACHE II) score was 22 (SD 9). One hundred eight (83%) patients had influenza A (46% …
RESULTS: ne hundred thirty patients with confirmed influenza infection had a mean age of 56 (SD 16) years; 72 (55%) were male. Mean Acute Ph …
Evaluating electrochemical accessibility of 4fn5d1 and 4fn+1 Ln(II) ions in (C5H4SiMe3)3Ln and (C5Me4H)3Ln complexes.
Trinh MT, Wedal JC, Evans WJ. Trinh MT, et al. Dalton Trans. 2021 Oct 19;50(40):14384-14389. doi: 10.1039/d1dt02427b. Dalton Trans. 2021. PMID: 34569559
Fc(+)/Fc) for a series of Cp'(3)Ln complexes (Cp' = C(5)H(4)SiMe(3), Ln = lanthanide) were determined via electrochemistry in THF with [(n)Bu(4)N][BPh(4)] as the supporting electrolyte. The Ln(III)/Ln(II) reduction potentials for Ln = Eu, Yb, Sm, and Tm (-1.07 to -2.83 V) …
Fc(+)/Fc) for a series of Cp'(3)Ln complexes (Cp' = C(5)H(4)SiMe(3), Ln = lanthanide) were determined via electrochemistry in THF with [(n)B …
402 results