Skip to main page content
Access keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation

Search Page

My NCBI Filters
Results by year

Table representation of search results timeline featuring number of search results per year.

Year Number of Results
1967 1
1976 1
1977 2
1981 2
1982 1
1983 1
1984 2
1985 3
1986 2
1987 2
1989 4
1990 3
1991 2
1992 2
1993 5
1994 4
1995 2
1996 4
1997 8
1998 5
1999 12
2000 8
2001 11
2002 10
2003 17
2004 16
2005 11
2006 17
2007 11
2008 16
2009 19
2010 19
2011 19
2012 11
2013 18
2014 34
2015 33
2016 28
2017 20
2018 28
2019 30
2020 38
2021 54
2022 44
Text availability
Article attribute
Article type
Publication date

Search Results

524 results
Results by year
Filters applied: . Clear all The following terms were ignored: %, %, %, % The following terms were not found in PubMed: 22Chrousos, 5BAuthor
Page 1
Biologics for chronic rhinosinusitis.
Chong LY, Piromchai P, Sharp S, Snidvongs K, Philpott C, Hopkins C, Burton MJ. Chong LY, et al. Cochrane Database Syst Rev. 2020 Feb 27;2(2):CD013513. doi: 10.1002/14651858.CD013513.pub2. Cochrane Database Syst Rev. 2020. PMID: 32102112 Free PMC article. Updated.
At 24 weeks, the SNOT-22 score was 19.61 points lower (better) in participants receiving dupilumab (mean difference (MD) -19.61, 95% confidence interval (CI) -22.54 to -16.69; 3 studies; 784 participants; high certainty). ...Anti-IL-5 mAb (mepolizumab) versusplacebo …
At 24 weeks, the SNOT-22 score was 19.61 points lower (better) in participants receiving dupilumab (mean difference (MD) -19.61, 95% …
EQ-5D-5L-based quality of life normative data for patients with self-reported diabetes in Poland.
Jankowska A, Golicki D. Jankowska A, et al. PLoS One. 2021 Sep 29;16(9):e0257998. doi: 10.1371/journal.pone.0257998. eCollection 2021. PLoS One. 2021. PMID: 34587218 Free PMC article.
INTRODUCTION: The new, five-level EQ-5D generic questionnaire (EQ-5D-5L) has never been used among diabetes patients in Poland. ...We estimated three types of EQ-5D-5L outcomes: limitations within domains, EQ VAS and EQ-5D-5L index. ...
INTRODUCTION: The new, five-level EQ-5D generic questionnaire (EQ-5D-5L) has never been used among diabetes patients in Poland …
Tiotropium / Olodaterol -- Addendum to Commission A15-31 [Internet].
Institute for Quality and Efficiency in Health Care. Institute for Quality and Efficiency in Health Care. Cologne, Germany: Institute for Quality and Efficiency in Health Care (IQWiG); 2016 Jan 14. Extract of Dossier Assessment No. A15-57. Cologne, Germany: Institute for Quality and Efficiency in Health Care (IQWiG); 2016 Jan 14. Extract of Dossier Assessment No. A15-57. PMID: 29144706 Free Books & Documents. Review.
Background On 22 December 2015, the Federal Joint Committee (G-BA) commissioned the Institute for Quality and Efficiency in Health Care (IQWiG) to conduct supplementary assessments for Commission A15-31 (Tiotropium / Olodaterol - Benefit Assessment According to 35a …
Background On 22 December 2015, the Federal Joint Committee (G-BA) commissioned the Institute for Quality and Efficiency in He …
Comparison of the three-level and the five-level versions of the EQ-5D.
Christiansen ASJ, Møller MLS, Kronborg C, Haugan KJ, Køber L, Højberg S, Brandes A, Graff C, Diederichsen SZ, Nielsen JB, Krieger D, Holst AG, Svendsen JH. Christiansen ASJ, et al. Eur J Health Econ. 2021 Jun;22(4):621-628. doi: 10.1007/s10198-021-01279-z. Epub 2021 Mar 18. Eur J Health Econ. 2021. PMID: 33733344
A total of 1002 persons diagnosed with hypertension, diabetes, heart failure, and/or previous stroke completed both the EQ-5D-3L and the EQ-5D-5L questionnaires. The overall ceiling effect decreased from 46% with the EQ-5D-3L to 30% with the EQ-5D-5L a …
A total of 1002 persons diagnosed with hypertension, diabetes, heart failure, and/or previous stroke completed both the EQ-5D-3L and …
Health-Related Quality of Life Among Patients With HR+/HER2- Early Breast Cancer.
Criscitiello C, Spurden D, Piercy J, Rider A, Williams R, Mitra D, Wild R, Corsaro M, Kurosky SK, Law EH. Criscitiello C, et al. Clin Ther. 2021 Jul;43(7):1228-1244.e4. doi: 10.1016/j.clinthera.2021.04.020. Epub 2021 Jul 11. Clin Ther. 2021. PMID: 34256965
Descriptive summary statistics were reported for FACT-B, Functional Assessment of Cancer Therapy-General (FACT-G) (total and specific subscales), the EQ-5D index scores, and the EQ-VAS scores for each country. ...In addition, mean scores were comparable between the …
Descriptive summary statistics were reported for FACT-B, Functional Assessment of Cancer Therapy-General (FACT-G) (total and specific …
Microbubbles conjugated with knottin 2.5D.
Leung K. Leung K. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. PMID: 21204315 Free Books & Documents. Review.
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2.5D (with three disulfide bonds; GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCG-NH(2)) was identified from a series of genetically engineered knottin …
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2. …
Complications and outcome after rib fracture fixation: A systematic review.
Peek J, Beks RB, Hietbrink F, Heng M, De Jong MB, Beeres FJP, Leenen LPH, Groenwold RHH, Houwert RM. Peek J, et al. J Trauma Acute Care Surg. 2020 Aug;89(2):411-418. doi: 10.1097/TA.0000000000002716. J Trauma Acute Care Surg. 2020. PMID: 32282759
The most frequently used questionnaire to assess patient quality of life was the EuroQol-5D (EQ-5D) (n = 4). Four studies reporting on the EQ-5D had a weighted mean EQ-5D index of 0.80 indicating good quality of life after rib fracture fixation. ...
The most frequently used questionnaire to assess patient quality of life was the EuroQol-5D (EQ-5D) (n = 4). Four studies repo …
Five-Year Outcomes of a Randomized Trial of Treatments for Varicose Veins.
Brittenden J, Cooper D, Dimitrova M, Scotland G, Cotton SC, Elders A, MacLennan G, Ramsay CR, Norrie J, Burr JM, Campbell B, Bachoo P, Chetter I, Gough M, Earnshaw J, Lees T, Scott J, Baker SA, Tassie E, Francis J, Campbell MK. Brittenden J, et al. N Engl J Med. 2019 Sep 5;381(10):912-922. doi: 10.1056/NEJMoa1805186. N Engl J Med. 2019. PMID: 31483962 Free article. Clinical Trial.
Primary outcomes at 5 years were disease-specific quality of life and generic quality of life, as well as cost-effectiveness based on models of expected costs and quality-adjusted life-years (QALYs) gained that used data on participants' treatment costs and scores on the EuroQol …
Primary outcomes at 5 years were disease-specific quality of life and generic quality of life, as well as cost-effectiveness based on models …
Precision Measurements of the ^{138}Ba^{+} 6s^{2}S_{1/2}-5d^{2}D_{5/2} Clock Transition.
Arnold KJ, Kaewuam R, Chanu SR, Tan TR, Zhang Z, Barrett MD. Arnold KJ, et al. Phys Rev Lett. 2020 May 15;124(19):193001. doi: 10.1103/PhysRevLett.124.193001. Phys Rev Lett. 2020. PMID: 32469594
The Lande g_{J} factor for the ^{2}D_{5/2} level is determined to be g_{D}=1.20036739(24), which is a 30-fold improvement on previous measurements. The g-factor measurements are corrected for an ac-magnetic field from trap-drive-induced currents in the electr …
The Lande g_{J} factor for the ^{2}D_{5/2} level is determined to be g_{D}=1.20036739(24), which is a 30-fold improvement on p …
In Vitro Anti-Candida Activity and Action Mode of Benzoxazole Derivatives.
Staniszewska M, Kuryk Ł, Gryciuk A, Kawalec J, Rogalska M, Baran J, Łukowska-Chojnacka E, Kowalkowska A. Staniszewska M, et al. Molecules. 2021 Aug 18;26(16):5008. doi: 10.3390/molecules26165008. Molecules. 2021. PMID: 34443595 Free PMC article.
A newly synthetized series of N-phenacyl derivatives of 2-mercaptobenzoxazole, including analogues of 5-bromo- and 5,7-dibromobenzoxazole, were screened against Candida strains and the action mechanism was evaluated. 2-(1,3-benzoxazol-2-ylsulfanyl)-1-(4-bromophenyl)ethanone (5
A newly synthetized series of N-phenacyl derivatives of 2-mercaptobenzoxazole, including analogues of 5-bromo- and 5,7-dibromobenzoxazole, w …
524 results