Skip to main page content
U.S. flag

An official website of the United States government

Dot gov

The .gov means it’s official.
Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you’re on a federal government site.

Https

The site is secure.
The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.

Access keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation

Search Page

Filters

My NCBI Filters

Results by year

Table representation of search results timeline featuring number of search results per year.

Year Number of Results
1993 1
1994 1
1997 1
1998 1
1999 1
2000 2
2004 1
2005 1
2006 2
2007 2
2008 1
2010 4
2011 3
2012 2
2013 4
2014 2
2015 1
2016 6
2017 6
2018 3
2019 4
2020 2
2021 7
2022 5
2024 0

Text availability

Article attribute

Article type

Publication date

Search Results

55 results

Results by year

Filters applied: . Clear all
Your search was processed without automatic term mapping because it retrieved zero results.
The following terms were ignored: %, %, %, %
The following terms were not found in PubMed: 22Hemolysin, 5BMeSH
Page 1
Increased MYBL2 expression in aggressive hormone-sensitive prostate cancer.
Yoshikawa Y, Stopsack KH, Wang XV, Chen YH, Mazzu YZ, Burton F, Chakraborty G, Rajanala SH, Hirani R, Nandakumar S, Lee GM, Frank D, Davicioni E, Liu G, Carducci MA, Azuma H, Kantoff PW, Sweeney CJ. Yoshikawa Y, et al. Mol Oncol. 2022 Dec;16(22):3994-4010. doi: 10.1002/1878-0261.13314. Epub 2022 Oct 2. Mol Oncol. 2022. PMID: 36087093 Free PMC article.
Loss of the histone demethylase KDM5D (lysine-specific demethylase 5D) leads to in vitro resistance of prostate cancer cells to androgen deprivation therapy (ADT) with and without docetaxel. ...
Loss of the histone demethylase KDM5D (lysine-specific demethylase 5D) leads to in vitro resistance of prostate cancer cells to andro …
Bypassing agent prophylaxis in people with hemophilia A or B with inhibitors.
Chai-Adisaksopha C, Nevitt SJ, Simpson ML, Janbain M, Konkle BA. Chai-Adisaksopha C, et al. Cochrane Database Syst Rev. 2017 Sep 25;9(9):CD011441. doi: 10.1002/14651858.CD011441.pub2. Cochrane Database Syst Rev. 2017. PMID: 28944952 Free PMC article. Review.
The meta-analysis did not conclusively demonstrate significant benefit of prophylaxis on health-related quality of life as measured by Haem-A-QoL score, EQ-5D total score and utility score, EQ-5D VAS and SF-36 physical summary and mental summary score (low quality e …
The meta-analysis did not conclusively demonstrate significant benefit of prophylaxis on health-related quality of life as measured by Haem- …
Microbubbles conjugated with knottin 2.5D.
Leung K. Leung K. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. PMID: 21204315 Free Books & Documents. Review.
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2.5D (with three disulfide bonds; GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCG-NH(2)) was identified from a series of genetically engineered knottin …
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2. …
Protein Micropatterning in 2.5D: An Approach to Investigate Cellular Responses in Multi-Cue Environments.
van der Putten C, Buskermolen ABC, Werner M, Brouwer HFM, Bartels PAA, Dankers PYW, Bouten CVC, Kurniawan NA. van der Putten C, et al. ACS Appl Mater Interfaces. 2021 Jun 9;13(22):25589-25598. doi: 10.1021/acsami.1c01984. Epub 2021 May 25. ACS Appl Mater Interfaces. 2021. PMID: 34032413 Free PMC article.
Using a contactless and maskless UV-projection system, we created patterns of extracellular proteins (resembling contact-guidance cues) on a two-and-a-half-dimensional (2.5D) cell culture chip containing a library of well-defined microstructures (resembling topograp …
Using a contactless and maskless UV-projection system, we created patterns of extracellular proteins (resembling contact-guidance cue …
Venetoclax combined with low dose cytarabine compared to standard of care intensive chemotherapy for the treatment of favourable risk adult acute myeloid leukaemia (VICTOR): Study protocol for an international, open-label, multicentre, molecularly-guided randomised, phase II trial.
Dillon R, Maycock S, Jackson A, Fox S, Freeman S, Craddock C, Thomas C, Homer E, Leahy J, Mamwell A, Potter N, Russell N, Wei A, Ommen HB, Hemmaway C, Knapper S, Billingham L. Dillon R, et al. BMC Cancer. 2022 Nov 14;22(1):1174. doi: 10.1186/s12885-022-10221-2. BMC Cancer. 2022. PMID: 36376888 Free PMC article.
Secondary outcomes include cumulative resource use at 12- and 24-months, and QoL as assessed by EORTCQLQ-C30 and EQ-5D-3L at 3-, 6-, 12-, 18- and 24-months. The trial employs an innovative Bayesian design with target sample size of 156 patients aged > 60 years. ...
Secondary outcomes include cumulative resource use at 12- and 24-months, and QoL as assessed by EORTCQLQ-C30 and EQ-5D-3L at 3-, 6-, …
Quinazoline Based HSP90 Inhibitors: Synthesis, Modeling Study and ADME Calculations Towards Breast Cancer Targeting.
El-Shafey HW, Gomaa RM, El-Messery SM, Goda FE. El-Shafey HW, et al. Bioorg Med Chem Lett. 2020 Aug 1;30(15):127281. doi: 10.1016/j.bmcl.2020.127281. Epub 2020 May 21. Bioorg Med Chem Lett. 2020. PMID: 32527460
Compounds 5a and 9h showed higher IC(50) values of 3.21 and 3.41 muM, respectively. The effects of 5a, 5d and 9h on Her2 (a client proteins of HSP90) and HSP70 were evaluated in MCF-7 cells. All tested compounds were found to reduce Her2 protein expression levels an …
Compounds 5a and 9h showed higher IC(50) values of 3.21 and 3.41 muM, respectively. The effects of 5a, 5d and 9h on Her2 (a client …
Bis-Amiridines as Acetylcholinesterase and Butyrylcholinesterase Inhibitors: N-Functionalization Determines the Multitarget Anti-Alzheimer's Activity Profile.
Makhaeva GF, Kovaleva NV, Boltneva NP, Rudakova EV, Lushchekina SV, Astakhova TY, Serkov IV, Proshin AN, Radchenko EV, Palyulin VA, Korabecny J, Soukup O, Bachurin SO, Richardson RJ. Makhaeva GF, et al. Molecules. 2022 Feb 4;27(3):1060. doi: 10.3390/molecules27031060. Molecules. 2022. PMID: 35164325 Free PMC article.
The lead compounds 3a-c exhibited an IC(50)(AChE) = 2.9-1.4 M, IC(50)(BChE) = 0.13-0.067 M, and 14-18% propidium displacement at 20 muM. Kinetic studies of compounds 3a and 5d indicated mixed-type reversible inhibition. Molecular docking revealed favorable poses in both ca …
The lead compounds 3a-c exhibited an IC(50)(AChE) = 2.9-1.4 M, IC(50)(BChE) = 0.13-0.067 M, and 14-18% propidium displacement at 20 muM. Kin …
Yield-Related QTL Clusters and the Potential Candidate Genes in Two Wheat DH Populations.
Zhang J, She M, Yang R, Jiang Y, Qin Y, Zhai S, Balotf S, Zhao Y, Anwar M, Alhabbar Z, Juhász A, Chen J, Liu H, Liu Q, Zheng T, Yang F, Rong J, Chen K, Lu M, Islam S, Ma W. Zhang J, et al. Int J Mol Sci. 2021 Nov 3;22(21):11934. doi: 10.3390/ijms222111934. Int J Mol Sci. 2021. PMID: 34769361 Free PMC article.
The QTL clusters with consistently positive correlations were suggested to be directly utilized in wheat breeding, including 1B.2, 2A.2, 2B (4.9-16.5 Mb), 2B.3, 3B (68.9-214.5 Mb), 4A.2, 4B.2, 4D, 5A.1, 5A.2, 5B.1, and 5D. The QTL clusters with negative alignments between …
The QTL clusters with consistently positive correlations were suggested to be directly utilized in wheat breeding, including 1B.2, 2A.2, 2B …
Association of acute inflammatory cytokines, fracture malreduction, and functional outcome 12 months after intra-articular ankle fracture-a prospective cohort study of 46 patients with ankle fractures.
Pham TM, Kristiansen EB, Frich LH, Lambertsen KL, Overgaard S, Schmal H. Pham TM, et al. J Orthop Surg Res. 2021 May 25;16(1):338. doi: 10.1186/s13018-021-02473-8. J Orthop Surg Res. 2021. PMID: 34034772 Free PMC article.
METHODS: During surgery, synovial fluid from the fractured and healthy contralateral ankles of 46 patients was collected for chemiluminescence analysis of 22 inflammatory cytokines and metabolic proteins. The quality of fracture reduction was based on 9 criteria on …
METHODS: During surgery, synovial fluid from the fractured and healthy contralateral ankles of 46 patients was collected for chemiluminescen …
55 results