Skip to main page content
U.S. flag

An official website of the United States government

Dot gov

The .gov means it’s official.
Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you’re on a federal government site.

Https

The site is secure.
The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.

Access keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation

Search Page

Filters

My Custom Filters

Edit custom filters

Results by year

Table representation of search results timeline featuring number of search results per year.

Year Number of Results
1977 1
1981 1
1984 1
1986 4
1987 2
1988 3
1989 1
1990 2
1991 4
1992 3
1993 6
1994 5
1995 3
1996 2
1997 6
1998 5
1999 7
2000 3
2001 8
2002 13
2003 14
2004 18
2005 21
2006 36
2007 34
2008 41
2009 42
2010 66
2011 63
2012 117
2013 155
2014 122
2015 120
2016 146
2017 168
2018 173
2019 211
2020 231
2021 327
2022 350
2023 295
2024 342
2025 346
2026 146

Publication date

Text availability

Article attribute

Article type

Additional filters

Article Language

Species

Sex

Age

Other

Search Results

3,169 results

Results by year

Filters applied: . Clear all
Your search was processed without automatic term mapping because it retrieved zero results.
The following terms were ignored: %, %, %, %
The following terms were not found in PubMed: 22Hristov, 5BAuthor
Page 1
EQ-5D-5L Population Norms for China Derived From a National Health Survey.
Li DL, Wang ZT, Nie XY, Luo N, Wu YB, Pan CW, Wang P. Li DL, et al. Value Health. 2024 Aug;27(8):1108-1120. doi: 10.1016/j.jval.2024.04.014. Epub 2024 Apr 26. Value Health. 2024. PMID: 38677363 Free article.
OBJECTIVES: To develop the EQ-5D-5L (5L) population norms for China and to assess the relationship between various factors and 5L data. ...Participants reported considerably more problems in anxiety/depression (26.2%) and pain/discomfort (22.2%) dimensions. The gend …
OBJECTIVES: To develop the EQ-5D-5L (5L) population norms for China and to assess the relationship between various factors and 5L dat …
Improvements in Patient-Reported Outcomes in Relapsed or Refractory Large B-Cell Lymphoma Patients Treated With Epcoritamab.
Phillips T, Lugtenburg P, Kalsekar A, Mutebi A, Wang A, Blaedel J, Kosa K, Martin S, Sacchi M, Kilavuz N, Thieblemont C. Phillips T, et al. Clin Lymphoma Myeloma Leuk. 2024 Mar;24(3):e78-e87.e2. doi: 10.1016/j.clml.2023.11.005. Epub 2023 Nov 27. Clin Lymphoma Myeloma Leuk. 2024. PMID: 38151388 Free article.
FACT-Lym and EQ-5D-3L score changes from baseline (CFB) to cycle 9 or end of treatment were interpreted using published minimally important differences (MID). ...FACT-Lym scores exceeded MID thresholds: mean (SD) CFB were 4.4 (15.2), MID 3.0 to 7.0 (FACT-General); 5.9 (7.6 …
FACT-Lym and EQ-5D-3L score changes from baseline (CFB) to cycle 9 or end of treatment were interpreted using published minimally imp …
Testing Nonmonotonicity in Health Preferences.
Abellan-Perpiñan JM, Martinez-Perez JE, Pinto-Prades JL, Sanchez-Martinez FI. Abellan-Perpiñan JM, et al. Med Decis Making. 2024 Jan;44(1):42-52. doi: 10.1177/0272989X231207814. Epub 2023 Nov 10. Med Decis Making. 2024. PMID: 37947086
RESULTS: Monotonicity is frequently violated across the 7 EQ-5D health states. Preference patterns for individuals describe violations ranging from almost 49% with choices to about 71% with rankings. ...Our study reports significant rates of nonmonotonic preferences (or ma …
RESULTS: Monotonicity is frequently violated across the 7 EQ-5D health states. Preference patterns for individuals describe violation …
Validity of an enhanced EQ-5D-5L measure with an added cognitive dimension in patients with stroke.
de Graaf JA, Kuijpers M, Visser-Meily J, Kappelle LJ, Post M. de Graaf JA, et al. Clin Rehabil. 2020 Apr;34(4):545-550. doi: 10.1177/0269215520907990. Epub 2020 Feb 19. Clin Rehabil. 2020. PMID: 32070131
Cognitive problems were reported by 199 (55%) patients three months post-stroke. Internal consistencies of the EQ-5D-5L and EQ-5D-5L+C were 0.75 and 0.77, respectively. Adding a cognitive domain resulted in a decrease of the ceiling effect from 22% to 14%. Bo …
Cognitive problems were reported by 199 (55%) patients three months post-stroke. Internal consistencies of the EQ-5D-5L and EQ-5D
7-(Benzyl-sulfan-yl)-5-(2-methoxy-phen-yl)-1,3-dimethyl-5,6-dihydro-pyrimido[4,5-d]pyrimidine-2,4(1H,3H)-dione.
Bazgir A, Faraji F. Bazgir A, et al. Acta Crystallogr Sect E Struct Rep Online. 2008 Aug 6;64(Pt 9):o1666. doi: 10.1107/S160053680802401X. Acta Crystallogr Sect E Struct Rep Online. 2008. PMID: 21201659 Free PMC article.
In the mol-ecule of the title compound, C(22)H(22)N(4)O(3)S, the benzene and phenyl rings are oriented at a dihedral angle of 88.72 (4) . ...
In the mol-ecule of the title compound, C(22)H(22)N(4)O(3)S, the benzene and phenyl rings are oriented at a dihedral angle of …
Temporal properties of positive and negative defocus on emmetropization.
Zhu X, Kang P, Troilo D, Benavente-Perez A. Zhu X, et al. Sci Rep. 2022 Mar 4;12(1):3582. doi: 10.1038/s41598-022-07621-6. Sci Rep. 2022. PMID: 35246571 Free PMC article.
A total of forty-six marmosets were treated monocularly with soft contact lenses for 4 weeks from 10 weeks of age (OD: + 5D or - 5D; OS: plano). Two control groups wore + 5D (n = 5) or - 5D (n = 13) lenses continuously for 9 h/day. ...Interrupting defo …
A total of forty-six marmosets were treated monocularly with soft contact lenses for 4 weeks from 10 weeks of age (OD: + 5D or - 5
Low dose naloxone for pruritus in systemic sclerosis: Case series and literature review.
Meridor K, Berookhim J, Levy Y. Meridor K, et al. Medicine (Baltimore). 2022 Jan 28;101(4):e28653. doi: 10.1097/MD.0000000000028653. Medicine (Baltimore). 2022. PMID: 35089206 Free PMC article. Review.
PATIENT CONCERNS AND DIAGNOSIS: We describe 4 female patients with systemic sclerosis suffering from severe pruritus, with an average 5D-itch score of 22.75. INTERVENTION AND OUTCOMES: Low-dose oral naloxone was initiated, followed by a significant improvement in th …
PATIENT CONCERNS AND DIAGNOSIS: We describe 4 female patients with systemic sclerosis suffering from severe pruritus, with an average 5D
Atlas Argentino de Calidad de Vida Relacionada con la Salud: Análisis de los datos de la Encuesta Nacional de Factores de Riesgo por Provincias.
Augustovski F, Rey-Ares L, Gibbons L. Augustovski F, et al. Value Health Reg Issues. 2013 Dec;2(3):398-404. doi: 10.1016/j.vhri.2013.10.006. Epub 2013 Dec 12. Value Health Reg Issues. 2013. PMID: 29702777 Free article. Spanish.
METHODS: Secondary cross-sectional study analyzing EQ-5D-3L responses. The variables of interest were self-reported visual analog scale in a 0-1 scale (SR-VAS), as well as time-trade off (TTO) and VAS preference values (PV). ...RESULTS: The survey included 41.392 subjects; …
METHODS: Secondary cross-sectional study analyzing EQ-5D-3L responses. The variables of interest were self-reported visual analog sca …
The EQ-5D-5L valuation study for Trinidad and Tobago.
Bailey H, Jonker MF, Pullenayegum E, Rencz F, Roudijk B. Bailey H, et al. Health Qual Life Outcomes. 2024 Jul 2;22(1):51. doi: 10.1186/s12955-024-02266-7. Health Qual Life Outcomes. 2024. PMID: 38956543 Free PMC article.
PURPOSE: The 2016 EQ-5D-3L value set for Trinidad and Tobago (T&T) allows for the calculation of EQ-5D-5L values via the crosswalk algorithm. The 2016 value set was based on methods predating the EQ-VT protocol, now considered the gold standard for developing EQ …
PURPOSE: The 2016 EQ-5D-3L value set for Trinidad and Tobago (T&T) allows for the calculation of EQ-5D-5L values via the c …
Microbubbles conjugated with knottin 2.5D.
Leung K. Leung K. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. PMID: 21204315 Free Books & Documents. Review.
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2.5D (with three disulfide bonds; GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCG-NH(2)) was identified from a series of genetically engineered knottin …
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2. …
3,169 results