Skip to main page content
Access keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation

Search Page

My NCBI Filters
Results by year

Table representation of search results timeline featuring number of search results per year.

Year Number of Results
1985 1
1986 2
1987 3
1988 1
1989 3
1992 4
1993 6
1995 2
1996 2
1997 4
1998 3
1999 3
2000 2
2002 3
2003 4
2004 3
2005 1
2006 6
2007 9
2008 7
2009 7
2010 5
2011 7
2012 5
2013 8
2014 6
2015 8
2016 14
2017 14
2018 9
2019 10
2020 15
2021 21
2022 24
Text availability
Article attribute
Article type
Publication date

Search Results

201 results
Results by year
Filters applied: . Clear all The following terms were ignored: %, %, %, % The following terms were not found in PubMed: 22Milani, 5BAuthor
Page 1
Timing and Dose of Upper Limb Motor Intervention After Stroke: A Systematic Review.
Hayward KS, Kramer SF, Dalton EJ, Hughes GR, Brodtmann A, Churilov L, Cloud G, Corbett D, Jolliffe L, Kaffenberger T, Rethnam V, Thijs V, Ward N, Lannin N, Bernhardt J. Hayward KS, et al. Stroke. 2021 Nov;52(11):3706-3717. doi: 10.1161/STROKEAHA.121.034348. Epub 2021 Oct 4. Stroke. 2021. PMID: 34601901
Timing of intervention start has not changed (median 38 days, interquartile range [IQR], 22-66) and study sample size remains small (median n=30, IQR 20-48). ...
Timing of intervention start has not changed (median 38 days, interquartile range [IQR], 22-66) and study sample size remains small ( …
Evaluation of Quality of Life After Nonoperative or Operative Management of Proximal Femoral Fractures in Frail Institutionalized Patients: The FRAIL-HIP Study.
Loggers SAI, Willems HC, Van Balen R, Gosens T, Polinder S, Ponsen KJ, Van de Ree CLP, Steens J, Verhofstad MHJ, Zuurmond RG, Van Lieshout EMM, Joosse P; FRAIL-HIP Study Group. Loggers SAI, et al. JAMA Surg. 2022 May 1;157(5):424-434. doi: 10.1001/jamasurg.2022.0089. JAMA Surg. 2022. PMID: 35234817
The term frail implied at least 1 of the following characteristics was present: malnutrition (body mass index [calculated as weight in kilograms divided by height in meters squared] <18.5) or cachexia, severe comorbidities (American Society of Anesthesiologists physical status …
The term frail implied at least 1 of the following characteristics was present: malnutrition (body mass index [calculated as weight in kilog …
Rhenium-Imido Corroles.
Alemayehu AB, Teat SJ, Borisov SM, Ghosh A. Alemayehu AB, et al. Inorg Chem. 2020 May 4;59(9):6382-6389. doi: 10.1021/acs.inorgchem.0c00477. Epub 2020 Apr 10. Inorg Chem. 2020. PMID: 32275406 Free PMC article.
Metallocorroles involving 5d transition metals are currently of interest as near-IR phosphors and as photosensitizers for oxygen sensing and photodynamic therapy. ...Details of the corrole skeletal bond distances, diamagnetic (1)H NMR spectra, relatively substituent-indepe …
Metallocorroles involving 5d transition metals are currently of interest as near-IR phosphors and as photosensitizers for oxygen sens …
Health-related quality-of-life outcomes in patients with advanced renal cell carcinoma treated with lenvatinib plus pembrolizumab or everolimus versus sunitinib (CLEAR): a randomised, phase 3 study.
Motzer R, Porta C, Alekseev B, Rha SY, Choueiri TK, Mendez-Vidal MJ, Hong SH, Kapoor A, Goh JC, Eto M, Bennett L, Wang J, Pan JJ, Saretsky TL, Perini RF, He CS, Mody K, Cella D. Motzer R, et al. Lancet Oncol. 2022 Jun;23(6):768-780. doi: 10.1016/S1470-2045(22)00212-1. Epub 2022 Apr 27. Lancet Oncol. 2022. PMID: 35489363 Clinical Trial.
Functional Assessment of Cancer Therapy Kidney Symptom Index-Disease-Related Symptoms (FKSI-DRS), European Organisation for the Research and Treatment of Cancer Quality of Life Questionnaire-Core 30 (EORTC QLQ-C30), and the EQ-5D-3 Level (EQ-5D-3L) preference questi …
Functional Assessment of Cancer Therapy Kidney Symptom Index-Disease-Related Symptoms (FKSI-DRS), European Organisation for the Research and …
Lanthanide Photocatalysis.
Qiao Y, Schelter EJ. Qiao Y, et al. Acc Chem Res. 2018 Nov 20;51(11):2926-2936. doi: 10.1021/acs.accounts.8b00336. Epub 2018 Oct 18. Acc Chem Res. 2018. PMID: 30335356
Among the lanthanides, we have focused on cerium because of the doublet to doublet 4f 5d excitation and emission, which affords good conservation of energy without losses through spin-state changes, as well as a large natural abundance of that element. ...We have also repo …
Among the lanthanides, we have focused on cerium because of the doublet to doublet 4f 5d excitation and emission, which affords good …
Synthesis, structures, and reactivity of isomers of [RuCp*(1,4-(Me2N)2C6H4)]2.
Longhi E, Risko C, Bacsa J, Khrustalev V, Rigin S, Moudgil K, Timofeeva TV, Marder SR, Barlow S. Longhi E, et al. Dalton Trans. 2021 Sep 28;50(37):13020-13030. doi: 10.1039/d1dt02155a. Dalton Trans. 2021. PMID: 34581359
[RuCp*(1,3,5-R(3)C(6)H(3))](2) {Cp* = eta(5)-pentamethylcyclopentadienyl, R = Me, Et} have previously been found to be moderately air stable, yet highly reducing, with estimated D(+)/0.5D(2) (where D(2) and D(+) represent the dimer and the corresponding monomeric cation, r …
[RuCp*(1,3,5-R(3)C(6)H(3))](2) {Cp* = eta(5)-pentamethylcyclopentadienyl, R = Me, Et} have previously been found to be moderately air stable …
Microbubbles conjugated with knottin 2.5D.
Leung K. Leung K. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. PMID: 21204315 Free Books & Documents. Review.
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2.5D (with three disulfide bonds; GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCG-NH(2)) was identified from a series of genetically engineered knottin …
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2. …
The impact of distance on post-ICU disability.
D'Arcy J, Haines K, Paul E, Doherty Z, Goodwin A, Bailey M, Barrett J, Bellomo R, Bucknall T, Gabbe BJ, Higgins AM, Iwashyna TJ, Murray LJ, Myles PS, Ponsford J, Pilcher D, Udy AA, Walker C, Young M, Cooper DJJ, Hodgson CL; ICU-Recovery Investigators. D'Arcy J, et al. Aust Crit Care. 2022 Jul;35(4):355-361. doi: 10.1016/j.aucc.2021.05.013. Epub 2021 Jul 25. Aust Crit Care. 2022. PMID: 34321180
This was recorded at 6 months after ICU admission by telephone interview. Secondary outcomes included health status as measured by EQ-5D-5L return to work and psychological function as measured by the Hospital Anxiety and Depression Scale (HADS). ...There was no difference …
This was recorded at 6 months after ICU admission by telephone interview. Secondary outcomes included health status as measured by EQ-5D
Twenty years of Dipterology through the pages of Zootaxa.
Whitmore D, Gaimari SD, Nihei SS, Evenhuis NL, Kurina O, Borkent CJ, Sinclair BJ, O'Hara JE, Zhang ZQ, Moulton JK, Ribeiro GC, Bickel DJ, Giłka W, Andersen T, Rossaro B, Whittington AE, Lamas CJE, Heller K, Kehlmaier C, Courtney GW, Kerr PH, Blagoderov V. Whitmore D, et al. Zootaxa. 2021 May 28;4979(1):166189. doi: 10.11646/zootaxa.4979.1.17. Zootaxa. 2021. PMID: 34187006
Altogether, 2,527 papers on Diptera were published, including 2,032 taxonomic papers and 1,931 papers containing new nomenclatural acts, equivalent to 22% of all publications with new nomenclatural acts for Diptera. ...
Altogether, 2,527 papers on Diptera were published, including 2,032 taxonomic papers and 1,931 papers containing new nomenclatural acts, equ …
Are lanthanide-transition metal direct bonds a route to achieving new generation {3d-4f} SMMs?
Swain A, Sen A, Rajaraman G. Swain A, et al. Dalton Trans. 2021 Nov 16;50(44):16099-16109. doi: 10.1039/d1dt02256c. Dalton Trans. 2021. PMID: 34647556
In this direction, we have modelled [PyCp(2)LnMCp(CO)(2)] (Ln = Gd(III), Dy(III), and Er(III) and M = V(0), Mn(0), Co(0) and Fe(I) and here PyCp(2) = [2,6-(CH(2)C(5)H(3))(2)C(5)H(3)N](2)(-) using [PyCp(2)DyFeCp(CO)(2)] as an example as reported by Nippe et al. ...Bonding a …
In this direction, we have modelled [PyCp(2)LnMCp(CO)(2)] (Ln = Gd(III), Dy(III), and Er(III) and M = V(0), Mn(0), Co(0) and Fe(I) an …
201 results