Skip to main page content
Access keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation

Search Page

My NCBI Filters
Results by year

Table representation of search results timeline featuring number of search results per year.

Year Number of Results
1967 1
1976 1
1977 2
1981 2
1982 1
1983 1
1984 2
1985 3
1986 2
1987 2
1989 4
1990 3
1991 2
1992 2
1993 5
1994 4
1995 2
1996 4
1997 8
1998 5
1999 12
2000 8
2001 11
2002 10
2003 17
2004 16
2005 11
2006 17
2007 11
2008 16
2009 19
2010 19
2011 19
2012 11
2013 18
2014 34
2015 33
2016 28
2017 20
2018 28
2019 30
2020 38
2021 54
2022 42
Text availability
Article attribute
Article type
Publication date

Search Results

522 results
Results by year
Filters applied: . Clear all The following terms were ignored: %, %, %, % The following terms were not found in PubMed: 22Piaditis, 5BAuthor
Page 1
Biologics for chronic rhinosinusitis.
Chong LY, Piromchai P, Sharp S, Snidvongs K, Philpott C, Hopkins C, Burton MJ. Chong LY, et al. Cochrane Database Syst Rev. 2020 Feb 27;2(2):CD013513. doi: 10.1002/14651858.CD013513.pub2. Cochrane Database Syst Rev. 2020. PMID: 32102112 Free PMC article. Updated.
At 24 weeks, the SNOT-22 score was 19.61 points lower (better) in participants receiving dupilumab (mean difference (MD) -19.61, 95% confidence interval (CI) -22.54 to -16.69; 3 studies; 784 participants; high certainty). ...Anti-IL-5 mAb (mepolizumab) versusplacebo …
At 24 weeks, the SNOT-22 score was 19.61 points lower (better) in participants receiving dupilumab (mean difference (MD) -19.61, 95% …
Health-Related Quality of Life Among Patients With HR+/HER2- Early Breast Cancer.
Criscitiello C, Spurden D, Piercy J, Rider A, Williams R, Mitra D, Wild R, Corsaro M, Kurosky SK, Law EH. Criscitiello C, et al. Clin Ther. 2021 Jul;43(7):1228-1244.e4. doi: 10.1016/j.clinthera.2021.04.020. Epub 2021 Jul 11. Clin Ther. 2021. PMID: 34256965
Descriptive summary statistics were reported for FACT-B, Functional Assessment of Cancer Therapy-General (FACT-G) (total and specific subscales), the EQ-5D index scores, and the EQ-VAS scores for each country. ...In addition, mean scores were comparable between the …
Descriptive summary statistics were reported for FACT-B, Functional Assessment of Cancer Therapy-General (FACT-G) (total and specific …
Comparison of the three-level and the five-level versions of the EQ-5D.
Christiansen ASJ, Møller MLS, Kronborg C, Haugan KJ, Køber L, Højberg S, Brandes A, Graff C, Diederichsen SZ, Nielsen JB, Krieger D, Holst AG, Svendsen JH. Christiansen ASJ, et al. Eur J Health Econ. 2021 Jun;22(4):621-628. doi: 10.1007/s10198-021-01279-z. Epub 2021 Mar 18. Eur J Health Econ. 2021. PMID: 33733344
A total of 1002 persons diagnosed with hypertension, diabetes, heart failure, and/or previous stroke completed both the EQ-5D-3L and the EQ-5D-5L questionnaires. The overall ceiling effect decreased from 46% with the EQ-5D-3L to 30% with the EQ-5D-5L a …
A total of 1002 persons diagnosed with hypertension, diabetes, heart failure, and/or previous stroke completed both the EQ-5D-3L and …
Tiotropium / Olodaterol -- Addendum to Commission A15-31 [Internet].
Institute for Quality and Efficiency in Health Care. Institute for Quality and Efficiency in Health Care. Cologne, Germany: Institute for Quality and Efficiency in Health Care (IQWiG); 2016 Jan 14. Extract of Dossier Assessment No. A15-57. Cologne, Germany: Institute for Quality and Efficiency in Health Care (IQWiG); 2016 Jan 14. Extract of Dossier Assessment No. A15-57. PMID: 29144706 Free Books & Documents. Review.
Background On 22 December 2015, the Federal Joint Committee (G-BA) commissioned the Institute for Quality and Efficiency in Health Care (IQWiG) to conduct supplementary assessments for Commission A15-31 (Tiotropium / Olodaterol - Benefit Assessment According to 35a …
Background On 22 December 2015, the Federal Joint Committee (G-BA) commissioned the Institute for Quality and Efficiency in He …
EQ-5D-5L-based quality of life normative data for patients with self-reported diabetes in Poland.
Jankowska A, Golicki D. Jankowska A, et al. PLoS One. 2021 Sep 29;16(9):e0257998. doi: 10.1371/journal.pone.0257998. eCollection 2021. PLoS One. 2021. PMID: 34587218 Free PMC article.
INTRODUCTION: The new, five-level EQ-5D generic questionnaire (EQ-5D-5L) has never been used among diabetes patients in Poland. ...We estimated three types of EQ-5D-5L outcomes: limitations within domains, EQ VAS and EQ-5D-5L index. ...
INTRODUCTION: The new, five-level EQ-5D generic questionnaire (EQ-5D-5L) has never been used among diabetes patients in Poland …
In Vitro Anti-Candida Activity and Action Mode of Benzoxazole Derivatives.
Staniszewska M, Kuryk Ł, Gryciuk A, Kawalec J, Rogalska M, Baran J, Łukowska-Chojnacka E, Kowalkowska A. Staniszewska M, et al. Molecules. 2021 Aug 18;26(16):5008. doi: 10.3390/molecules26165008. Molecules. 2021. PMID: 34443595 Free PMC article.
A newly synthetized series of N-phenacyl derivatives of 2-mercaptobenzoxazole, including analogues of 5-bromo- and 5,7-dibromobenzoxazole, were screened against Candida strains and the action mechanism was evaluated. 2-(1,3-benzoxazol-2-ylsulfanyl)-1-(4-bromophenyl)ethanone (5
A newly synthetized series of N-phenacyl derivatives of 2-mercaptobenzoxazole, including analogues of 5-bromo- and 5,7-dibromobenzoxazole, w …
Microbubbles conjugated with knottin 2.5D.
Leung K. Leung K. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. PMID: 21204315 Free Books & Documents. Review.
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2.5D (with three disulfide bonds; GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCG-NH(2)) was identified from a series of genetically engineered knottin …
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2. …
Precision Measurements of the ^{138}Ba^{+} 6s^{2}S_{1/2}-5d^{2}D_{5/2} Clock Transition.
Arnold KJ, Kaewuam R, Chanu SR, Tan TR, Zhang Z, Barrett MD. Arnold KJ, et al. Phys Rev Lett. 2020 May 15;124(19):193001. doi: 10.1103/PhysRevLett.124.193001. Phys Rev Lett. 2020. PMID: 32469594
The Lande g_{J} factor for the ^{2}D_{5/2} level is determined to be g_{D}=1.20036739(24), which is a 30-fold improvement on previous measurements. The g-factor measurements are corrected for an ac-magnetic field from trap-drive-induced currents in the electr …
The Lande g_{J} factor for the ^{2}D_{5/2} level is determined to be g_{D}=1.20036739(24), which is a 30-fold improvement on p …
Utilizing an electronic feeder to measure individual mineral intake, feeding behavior, and growth performance of cow-calf pairs grazing native range.
McCarthy KL, Undi M, Becker S, Dahlen CR. McCarthy KL, et al. Transl Anim Sci. 2021 Jan 21;5(1):txab007. doi: 10.1093/tas/txab007. eCollection 2021 Jan. Transl Anim Sci. 2021. PMID: 33659862 Free PMC article.

High-intake calves (>50 g/d; average 72.2 g/d) consumed greater (P < 0.001) amounts of minerals than low-intake calves (<50 g/d; average 22.2 g/d) intake calves. ...Cows with high mineral intake had greater (P < 0.01) concentrations

High-intake calves (>50 g/d; average 72.2 g/d) consumed greater (P < 0.001) amounts of minerals than low-intake calves (

[Clinical characteristics and risk factors of recurrent Kawasaki disease].
Tan AX, Tang XM. Tan AX, et al. Zhonghua Er Ke Za Zhi. 2021 Dec 2;59(12):1038-1042. doi: 10.3760/cma.j.cn112140-20210827-00710. Zhonghua Er Ke Za Zhi. 2021. PMID: 34856662 Chinese.
Compared with the first episode, the second episode had lower white blood cell count (15.2 (12.8-18.8)10(9) vs. 18.0 (14.9-23.4)10(9)/L, Z=-2.462, P=0.014) and rate of edema in extremities (54% (22/41) vs. 76% (31/41), chi(2)=4.321, P=0.038), shorter fever durations before …
Compared with the first episode, the second episode had lower white blood cell count (15.2 (12.8-18.8)10(9) vs. 18.0 (14.9-23.4)10(9)/L, Z=- …
522 results