Skip to main page content
U.S. flag

An official website of the United States government

Dot gov

The .gov means it’s official.
Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you’re on a federal government site.

Https

The site is secure.
The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.

Access keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation

Search Page

My NCBI Filters
Results by year

Table representation of search results timeline featuring number of search results per year.

Year Number of Results
1975 1
1976 1
1979 1
1980 1
1981 2
1983 3
1984 2
1985 2
1986 2
1987 5
1988 5
1989 6
1990 5
1991 6
1992 4
1993 13
1994 4
1995 8
1996 11
1997 20
1998 10
1999 18
2000 18
2001 20
2002 28
2003 9
2004 18
2005 21
2006 31
2007 29
2008 37
2009 38
2010 34
2011 34
2012 60
2013 57
2014 60
2015 61
2016 62
2017 67
2018 53
2019 59
2020 70
2021 94
2022 101
2023 5
Text availability
Article attribute
Article type
Publication date

Search Results

1,061 results
Results by year
Filters applied: . Clear all The following terms were ignored: %, %, %, % The following terms were not found in PubMed: 22Rolls, 5BAuthor
Page 1
Pharmacological interventions versus placebo, no treatment or usual care for osteoporosis in people with chronic kidney disease stages 3-5D.
Hara T, Hijikata Y, Matsubara Y, Watanabe N. Hara T, et al. Cochrane Database Syst Rev. 2021 Jul 7;7(7):CD013424. doi: 10.1002/14651858.CD013424.pub2. Cochrane Database Syst Rev. 2021. PMID: 34231877 Free PMC article.
MAIN RESULTS: Seven studies involving 9164 randomised participants with osteoporosis and CKD stages 3 to 5D met the inclusion criteria; all participants were postmenopausal women. Five studies included patients with CKD stages 3-4, and two studies included patients with CK …
MAIN RESULTS: Seven studies involving 9164 randomised participants with osteoporosis and CKD stages 3 to 5D met the inclusion criteri …
Efficacy and Safety of Difelikefalin in Japanese Patients With Moderate to Severe Pruritus Receiving Hemodialysis: A Randomized Clinical Trial.
Narita I, Tsubakihara Y, Uchiyama T, Okamura S, Oya N, Takahashi N, Gejyo F; MR13A9-4 Trial Investigators. Narita I, et al. JAMA Netw Open. 2022 May 2;5(5):e2210339. doi: 10.1001/jamanetworkopen.2022.10339. JAMA Netw Open. 2022. PMID: 35511180 Free PMC article. Clinical Trial.
DESIGN, SETTING, AND PARTICIPANTS: This randomized, double-blind, placebo-controlled, 4-arm phase 2 trial was conducted from February 1, 2019, to October 22, 2019, at 94 sites in Japan. Patients with moderate to severe pruritus receiving hemodialysis were enrolled. ...The …
DESIGN, SETTING, AND PARTICIPANTS: This randomized, double-blind, placebo-controlled, 4-arm phase 2 trial was conducted from February 1, 201 …
Erratum.
[No authors listed] [No authors listed] Mult Scler. 2016 Oct;22(12):NP9-NP11. doi: 10.1177/1352458515585718. Epub 2015 Jun 3. Mult Scler. 2016. PMID: 26041800
Over first two weeks 12% decrease in body sway from baseline. 22% increase in body sway over the next two weeks despite training. ...INTERVENTION: See Nilsagard et al.(25)Qualitative research approach. Interviewed (15-45 mins) within two weeks after the end of the i …
Over first two weeks 12% decrease in body sway from baseline. 22% increase in body sway over the next two weeks despite training. ... …
Complications and outcome after rib fracture fixation: A systematic review.
Peek J, Beks RB, Hietbrink F, Heng M, De Jong MB, Beeres FJP, Leenen LPH, Groenwold RHH, Houwert RM. Peek J, et al. J Trauma Acute Care Surg. 2020 Aug;89(2):411-418. doi: 10.1097/TA.0000000000002716. J Trauma Acute Care Surg. 2020. PMID: 32282759
The most frequently used questionnaire to assess patient quality of life was the EuroQol-5D (EQ-5D) (n = 4). Four studies reporting on the EQ-5D had a weighted mean EQ-5D index of 0.80 indicating good quality of life after rib fracture fixation. ...
The most frequently used questionnaire to assess patient quality of life was the EuroQol-5D (EQ-5D) (n = 4). Four studies repo …
Treatment patterns, effectiveness, and patient-reported outcomes of palbociclib therapy in Chinese patients with advanced breast cancer: A multicenter ambispective real-world study.
Shen L, Zhou J, Chen Y, Ding J, Wei H, Liu J, Xia W, Xie B, Xie X, Li X, Dai Y, Zhang G, Qiu X, Li C, Sun S, Chen W, Gong D, Li H, Huang J, Jiang X, Ni C. Shen L, et al. Cancer Med. 2022 Nov;11(22):4157-4168. doi: 10.1002/cam4.4767. Epub 2022 Apr 25. Cancer Med. 2022. PMID: 35470572 Free PMC article.
This study aims to assess the efficacy, safety and patient-reported outcomes (PROs) of palbociclib plus endocrine therapy (ET) in real-world China. METHODS: An ambispective cohort study was conducted on patients with advanced HR+HER2- breast cancer who received palbociclib …
This study aims to assess the efficacy, safety and patient-reported outcomes (PROs) of palbociclib plus endocrine therapy (ET) in rea …
Long-term outcomes of dexamethasone 12 mg versus 6 mg in patients with COVID-19 and severe hypoxaemia.
Granholm A, Kjær MN, Munch MW, Myatra SN, Vijayaraghavan BKT, Cronhjort M, Wahlin RR, Jakob SM, Cioccari L, Vesterlund GK, Meyhoff TS, Helleberg M, Møller MH, Benfield T, Venkatesh B, Hammond NE, Micallef S, Bassi A, John O, Jha V, Kristiansen KT, Ulrik CS, Jørgensen VL, Smitt M, Bestle MH, Andreasen AS, Poulsen LM, Rasmussen BS, Brøchner AC, Strøm T, Møller A, Khan MS, Padmanaban A, Divatia JV, Saseedharan S, Borawake K, Kapadia F, Dixit S, Chawla R, Shukla U, Amin P, Chew MS, Wamberg CA, Bose N, Shah MS, Darfelt IS, Gluud C, Lange T, Perner A. Granholm A, et al. Intensive Care Med. 2022 May;48(5):580-589. doi: 10.1007/s00134-022-06677-2. Epub 2022 Mar 31. Intensive Care Med. 2022. PMID: 35359168 Free PMC article. Clinical Trial.
RESULTS: We obtained vital status at 180 days for 963 of 982 patients (98.1%) in the intention-to-treat population, EQ-5D-5L index value data for 922 (93.9%) and EQ VAS data for 924 (94.1%). ...The adjusted mean differences between the 12 mg and the 6 mg groups in EQ-5D
RESULTS: We obtained vital status at 180 days for 963 of 982 patients (98.1%) in the intention-to-treat population, EQ-5D-5L index va …
Low dose naloxone for pruritus in systemic sclerosis: Case series and literature review.
Meridor K, Berookhim J, Levy Y. Meridor K, et al. Medicine (Baltimore). 2022 Jan 28;101(4):e28653. doi: 10.1097/MD.0000000000028653. Medicine (Baltimore). 2022. PMID: 35089206 Free PMC article. Review.
PATIENT CONCERNS AND DIAGNOSIS: We describe 4 female patients with systemic sclerosis suffering from severe pruritus, with an average 5D-itch score of 22.75. INTERVENTION AND OUTCOMES: Low-dose oral naloxone was initiated, followed by a significant improvement in th …
PATIENT CONCERNS AND DIAGNOSIS: We describe 4 female patients with systemic sclerosis suffering from severe pruritus, with an average 5D
Patient-reported outcomes of upadacitinib versus abatacept in patients with rheumatoid arthritis and an inadequate response to biologic disease-modifying antirheumatic drugs: 12- and 24-week results of a phase 3 trial.
Bergman M, Tundia N, Martin N, Suboticki JL, Patel J, Goldschmidt D, Song Y, Wright GC. Bergman M, et al. Arthritis Res Ther. 2022 Jun 24;24(1):155. doi: 10.1186/s13075-022-02813-x. Arthritis Res Ther. 2022. PMID: 35751108 Free PMC article. Clinical Trial.
PROs evaluated included Patient Global Assessment of Disease Activity (PtGA) by visual analog scale (VAS), patient's assessment of pain by VAS, Health Assessment Questionnaire Disability Index (HAQ-DI), morning stiffness duration and severity, 36-Item Short Form Health Survey (SF …
PROs evaluated included Patient Global Assessment of Disease Activity (PtGA) by visual analog scale (VAS), patient's assessment of pain by V …
Postintensive Care Syndrome in Survivors of Critical Illness Related to Coronavirus Disease 2019: Cohort Study From a New York City Critical Care Recovery Clinic.
Martillo MA, Dangayach NS, Tabacof L, Spielman LA, Dams-O'Connor K, Chan CC, Kohli-Seth R, Cortes M, Escalon MX. Martillo MA, et al. Crit Care Med. 2021 Sep 1;49(9):1427-1438. doi: 10.1097/CCM.0000000000005014. Crit Care Med. 2021. PMID: 33769771
Outcome measures assessed postintensive care syndrome symptoms in the physical (Modified Rankin Scale, Dalhousie Clinical Frailty Scale, Neuro-Quality of Life Upper Extremity and Lower Extremity Function, Neuro-Quality of Life Fatigue), psychiatric (Insomnia Severity Scale; Patie …
Outcome measures assessed postintensive care syndrome symptoms in the physical (Modified Rankin Scale, Dalhousie Clinical Frailty Scale, Neu …
Microbubbles conjugated with knottin 2.5D.
Leung K. Leung K. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. PMID: 21204315 Free Books & Documents. Review.
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2.5D (with three disulfide bonds; GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCG-NH(2)) was identified from a series of genetically engineered knottin …
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2. …
1,061 results