Skip to main page content
U.S. flag

An official website of the United States government

Dot gov

The .gov means it’s official.
Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you’re on a federal government site.

Https

The site is secure.
The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.

Access keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation

Search Page

Filters

My NCBI Filters

Results by year

Table representation of search results timeline featuring number of search results per year.

Year Number of Results
1988 1
1999 1
2004 2
2007 2
2010 2
2011 2
2012 3
2013 1
2015 1
2017 1
2018 1
2019 1
2020 3
2021 5
2022 6
2023 2
2024 0

Text availability

Article attribute

Article type

Publication date

Search Results

32 results

Results by year

Filters applied: . Clear all
The following terms were ignored: %, %, %, %
The following terms were not found in PubMed: 22User-Computer, 5BMAJR
Page 1
Progress, highlights and perspectives on NiO in perovskite photovoltaics.
Di Girolamo D, Di Giacomo F, Matteocci F, Marrani AG, Dini D, Abate A. Di Girolamo D, et al. Chem Sci. 2020 Jul 13;11(30):7746-7759. doi: 10.1039/d0sc02859b. Chem Sci. 2020. PMID: 34094149 Free PMC article. Review.
The power conversion efficiency (PCE) of NiO based perovskite solar cells has recently hit a record 22.1% with a hybrid organic-inorganic perovskite composition and a PCE above 15% in a fully inorganic configuration was achieved. ...Interface engineering strategies …
The power conversion efficiency (PCE) of NiO based perovskite solar cells has recently hit a record 22.1% with a hybrid organic-inorg …
Atomic Scale Control of Spin Current Transmission at Interfaces.
Wahada MA, Şaşıoğlu E, Hoppe W, Zhou X, Deniz H, Rouzegar R, Kampfrath T, Mertig I, Parkin SSP, Woltersdorf G. Wahada MA, et al. Nano Lett. 2022 May 11;22(9):3539-3544. doi: 10.1021/acs.nanolett.1c04358. Epub 2022 Apr 20. Nano Lett. 2022. PMID: 35442686 Free PMC article.
This is due to magnetic moment reduction at the interface caused by 3d-5d hybridization effects. We show that this effect can be avoided by atomically thin interlayers. On the basis of our theoretical model we conclude that this is a general effect and occurs for al …
This is due to magnetic moment reduction at the interface caused by 3d-5d hybridization effects. We show that this effect can …
Nonionic Surfactant Properties of Amphiphilic Hyperbranched Polyglycerols.
Andrade B, Knewstub SN, Harris K, Tucker CJ, Katz JS, Zimmerman SC. Andrade B, et al. Langmuir. 2020 Sep 1;36(34):10103-10109. doi: 10.1021/acs.langmuir.0c01349. Epub 2020 Aug 18. Langmuir. 2020. PMID: 32787037
Several surface properties, including critical micelle concentration (CMC), efficiency of surface tension reduction (pC(20)), effectiveness of surface tension reduction (gamma(CMC)), surface excess concentration at the CMC (gamma(max)), minimum area/molecule at the interface
Several surface properties, including critical micelle concentration (CMC), efficiency of surface tension reduction (pC(20)), effectiveness …
Microbubbles conjugated with knottin 2.5D.
Leung K. Leung K. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. PMID: 21204315 Free Books & Documents. Review.
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2.5D (with three disulfide bonds; GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCG-NH(2)) was identified from a series of genetically engineered knottin …
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2. …
Effect of femtosecond laser cutting parameters on the results of small-incision lenticule extraction.
Enayati S, Zhou W, Stojanovic A, Utheim TP, Bian Z, Feng Y, Chen X. Enayati S, et al. J Cataract Refract Surg. 2022 Nov 1;48(11):1253-1259. doi: 10.1097/j.jcrs.0000000000000965. J Cataract Refract Surg. 2022. PMID: 35537865
Postoperative interface light scattering was graded based on the percentage area showing light scattering: 0: no scattering; 1: 25%; 2: 26% to 50%; 3: 51% to 75%; and 4: >75%. ...CONCLUSIONS: Lower pulse energy with tighter spots seems to reduce interface
Postoperative interface light scattering was graded based on the percentage area showing light scattering: 0: no scattering; 1: 25%; …
Wearable SiPM-Based NIRS Interface Integrated With Pulsed Laser Source.
Saha S, Lu Y, Lesage F, Sawan M. Saha S, et al. IEEE Trans Biomed Circuits Syst. 2019 Dec;13(6):1313-1323. doi: 10.1109/TBCAS.2019.2951539. Epub 2019 Nov 4. IEEE Trans Biomed Circuits Syst. 2019. PMID: 31689208
The integrated circuit was assembled on a printed circuit board (PCB) and also on a 2.5D silicon interposer platform of size 1 cm and interfaced with a silicon photomultiplier (SiPM), vertical cavity surface emitting laser (VCSEL) and other ancillary components such …
The integrated circuit was assembled on a printed circuit board (PCB) and also on a 2.5D silicon interposer platform of size 1 cm and …
Protein Micropatterning in 2.5D: An Approach to Investigate Cellular Responses in Multi-Cue Environments.
van der Putten C, Buskermolen ABC, Werner M, Brouwer HFM, Bartels PAA, Dankers PYW, Bouten CVC, Kurniawan NA. van der Putten C, et al. ACS Appl Mater Interfaces. 2021 Jun 9;13(22):25589-25598. doi: 10.1021/acsami.1c01984. Epub 2021 May 25. ACS Appl Mater Interfaces. 2021. PMID: 34032413 Free PMC article.
Using a contactless and maskless UV-projection system, we created patterns of extracellular proteins (resembling contact-guidance cues) on a two-and-a-half-dimensional (2.5D) cell culture chip containing a library of well-defined microstructures (resembling topographical c …
Using a contactless and maskless UV-projection system, we created patterns of extracellular proteins (resembling contact-guidance cues) on a …
Intraocular lens power calculation for the equine eye.
Meister U, Görig C, Murphy CJ, Haan H, Ohnesorge B, Boevé MH. Meister U, et al. BMC Vet Res. 2018 Apr 3;14(1):123. doi: 10.1186/s12917-018-1448-6. BMC Vet Res. 2018. PMID: 29615113 Free PMC article.
The refractive state, corneal curvature (keratometry) and the axial location of all optical interfaces (biometry) were measured. The influences of breed, height at the withers, gender and age on values obtained and the comparison between the left and right eye were evaluat …
The refractive state, corneal curvature (keratometry) and the axial location of all optical interfaces (biometry) were measured. The …
Emergent magnetism at transition-metal-nanocarbon interfaces.
Al Ma'Mari F, Rogers M, Alghamdi S, Moorsom T, Lee S, Prokscha T, Luetkens H, Valvidares M, Teobaldi G, Flokstra M, Stewart R, Gargiani P, Ali M, Burnell G, Hickey BJ, Cespedes O. Al Ma'Mari F, et al. Proc Natl Acad Sci U S A. 2017 May 30;114(22):5583-5588. doi: 10.1073/pnas.1620216114. Epub 2017 May 15. Proc Natl Acad Sci U S A. 2017. PMID: 28507160 Free PMC article.
Charge transfer at metallo-molecular interfaces may be used to design multifunctional hybrids with an emergent magnetization that may offer an eco-friendly and tunable alternative to conventional magnets and devices. Here, we investigate the origin of the magnetism arising …
Charge transfer at metallo-molecular interfaces may be used to design multifunctional hybrids with an emergent magnetization that may …
Atomic Bonding and Electronic Binding Energy of Two-Dimensional Bi/Li(110) Heterojunctions via BOLS-BB Model.
Bo M, Ge L, Li J, Li L, Yao C, Huang Z. Bo M, et al. ACS Omega. 2021 Jan 20;6(4):3252-3258. doi: 10.1021/acsomega.0c05712. eCollection 2021 Feb 2. ACS Omega. 2021. PMID: 33553943 Free PMC article.
Thus, we obtained the following quantitative information: (i) the field-shaped structure can be considered the bulk structure; (ii) the field-shaped structure of Bi atom formation has a 5d energy level of 22.727 eV, and in the letter shape structure, this energy is …
Thus, we obtained the following quantitative information: (i) the field-shaped structure can be considered the bulk structure; (ii) the fiel …
32 results