Skip to main page content
U.S. flag

An official website of the United States government

Dot gov

The .gov means it’s official.
Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you’re on a federal government site.

Https

The site is secure.
The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.

Access keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation

Search Page

Filters

My NCBI Filters

Results by year

Table representation of search results timeline featuring number of search results per year.

Year Number of Results
1977 1
1980 1
1981 1
1984 3
1988 2
1989 4
1992 1
1993 4
1994 7
1995 2
1996 1
1997 5
1998 4
1999 4
2000 10
2001 5
2002 10
2003 4
2004 8
2005 3
2006 7
2007 10
2008 5
2009 4
2010 8
2011 7
2012 11
2013 7
2014 11
2015 6
2016 13
2017 10
2018 10
2019 10
2020 7
2021 13
2022 8
2023 8
2024 2

Text availability

Article attribute

Article type

Publication date

Search Results

215 results

Results by year

Filters applied: . Clear all
Your search was processed without automatic term mapping because it retrieved zero results.
The following terms were ignored: %, %, %, %
The following terms were not found in PubMed: 22Cytoskeletal, 5BMAJR
Page 1
Vegan and Omnivorous High Protein Diets Support Comparable Daily Myofibrillar Protein Synthesis Rates and Skeletal Muscle Hypertrophy in Young Adults.
Monteyne AJ, Coelho MOC, Murton AJ, Abdelrahman DR, Blackwell JR, Koscien CP, Knapp KM, Fulford J, Finnigan TJA, Dirks ML, Stephens FB, Wall BT. Monteyne AJ, et al. J Nutr. 2023 Jun;153(6):1680-1695. doi: 10.1016/j.tjnut.2023.02.023. Epub 2023 Feb 22. J Nutr. 2023. PMID: 36822394 Free PMC article. Clinical Trial.
Resting and exercised daily myofibrillar protein synthesis (MyoPS) rates were assessed using deuterium oxide. In Phase 2, 22 healthy young adults (m = 11, f = 11; age: 24 1 y; BMI: 23 0 kg/m(2)) completed a 10 wk, high-volume (5 d/wk), progressive resistance exercise progr …
Resting and exercised daily myofibrillar protein synthesis (MyoPS) rates were assessed using deuterium oxide. In Phase 2, 22 healthy …
Human Protein Z.
Broze GJ Jr, Miletich JP. Broze GJ Jr, et al. J Clin Invest. 1984 Apr;73(4):933-8. doi: 10.1172/JCI111317. J Clin Invest. 1984. PMID: 6707212 Free PMC article.
Biochemistry of iodothyronine deiodination.
Köhrle J. Köhrle J. Acta Med Austriaca. 1988;15 Suppl 1:22-4. Acta Med Austriaca. 1988. PMID: 3051830 Review.
The purification to homogeneity and cloning of the substrate binding 27kDa subunit of 5'-deiodinase type I is currently performed and these experiments suggest a close similarity of this subunit in 5'D I and II, no evidence is found yet supporting a structural relationship to oth …
The purification to homogeneity and cloning of the substrate binding 27kDa subunit of 5'-deiodinase type I is currently performed and these …
Increased MYBL2 expression in aggressive hormone-sensitive prostate cancer.
Yoshikawa Y, Stopsack KH, Wang XV, Chen YH, Mazzu YZ, Burton F, Chakraborty G, Rajanala SH, Hirani R, Nandakumar S, Lee GM, Frank D, Davicioni E, Liu G, Carducci MA, Azuma H, Kantoff PW, Sweeney CJ. Yoshikawa Y, et al. Mol Oncol. 2022 Dec;16(22):3994-4010. doi: 10.1002/1878-0261.13314. Epub 2022 Oct 2. Mol Oncol. 2022. PMID: 36087093 Free PMC article.
Loss of the histone demethylase KDM5D (lysine-specific demethylase 5D) leads to in vitro resistance of prostate cancer cells to androgen deprivation therapy (ADT) with and without docetaxel. ...
Loss of the histone demethylase KDM5D (lysine-specific demethylase 5D) leads to in vitro resistance of prostate cancer cells to andro …
Exercise Training Improves Mitochondrial Bioenergetics of Natural Killer Cells.
Lin ML, Hsu CC, Fu TC, Lin YT, Huang YC, Wang JS. Lin ML, et al. Med Sci Sports Exerc. 2022 May 1;54(5):751-760. doi: 10.1249/MSS.0000000000002842. Epub 2021 Dec 23. Med Sci Sports Exerc. 2022. PMID: 34935709 Clinical Trial.
METHODS: Sixty healthy sedentary males were randomly assigned to engage in either high-intensity interval training (HIIT, 3-min intervals at 80% and 40% maximal O2, n = 20; age, 22.2 yr; body mass index [BMI], 24.3 kg.m-2) or moderate-intensity continuous training (MICT, s …
METHODS: Sixty healthy sedentary males were randomly assigned to engage in either high-intensity interval training (HIIT, 3-min intervals at …
Bypassing agent prophylaxis in people with hemophilia A or B with inhibitors.
Chai-Adisaksopha C, Nevitt SJ, Simpson ML, Janbain M, Konkle BA. Chai-Adisaksopha C, et al. Cochrane Database Syst Rev. 2017 Sep 25;9(9):CD011441. doi: 10.1002/14651858.CD011441.pub2. Cochrane Database Syst Rev. 2017. PMID: 28944952 Free PMC article. Review.
The meta-analysis did not conclusively demonstrate significant benefit of prophylaxis on health-related quality of life as measured by Haem-A-QoL score, EQ-5D total score and utility score, EQ-5D VAS and SF-36 physical summary and mental summary score (low quality e …
The meta-analysis did not conclusively demonstrate significant benefit of prophylaxis on health-related quality of life as measured by Haem- …
Microbubbles conjugated with knottin 2.5D.
Leung K. Leung K. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. 2010 Oct 20 [updated 2010 Dec 9]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. PMID: 21204315 Free Books & Documents. Review.
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2.5D (with three disulfide bonds; GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCG-NH(2)) was identified from a series of genetically engineered knottin …
The integrin-binding RGD motif was grafted into a knottin from trypsin inhibitor II of the squash plant (Ecballium elaterium). Knottin 2. …
Preheated milk proteins improve the stability of grape skin anthocyanins extracts.
He Z, Xu M, Zeng M, Qin F, Chen J. He Z, et al. Food Chem. 2016 Nov 1;210:221-7. doi: 10.1016/j.foodchem.2016.04.116. Epub 2016 Apr 26. Food Chem. 2016. PMID: 27211641
Whey proteins and casein, preheated at 50C and 60C for 15min, respectively, demonstrated the optimal protective effects. However, preheated whey proteins had a better protective effect on the thermal, oxidation and photo stability of GSAE, decreasing the thermal, ox …
Whey proteins and casein, preheated at 50C and 60C for 15min, respectively, demonstrated the optimal protective effects. However, pre …
Protein Micropatterning in 2.5D: An Approach to Investigate Cellular Responses in Multi-Cue Environments.
van der Putten C, Buskermolen ABC, Werner M, Brouwer HFM, Bartels PAA, Dankers PYW, Bouten CVC, Kurniawan NA. van der Putten C, et al. ACS Appl Mater Interfaces. 2021 Jun 9;13(22):25589-25598. doi: 10.1021/acsami.1c01984. Epub 2021 May 25. ACS Appl Mater Interfaces. 2021. PMID: 34032413 Free PMC article.
Using a contactless and maskless UV-projection system, we created patterns of extracellular proteins (resembling contact-guidance cues) on a two-and-a-half-dimensional (2.5D) cell culture chip containing a library of well-defined microstructures (resembling topograp …
Using a contactless and maskless UV-projection system, we created patterns of extracellular proteins (resembling contact-guidance cue …
Gluconeogenesis and protein-induced satiety.
Veldhorst MA, Westerterp KR, Westerterp-Plantenga MS. Veldhorst MA, et al. Br J Nutr. 2012 Feb;107(4):595-600. doi: 10.1017/S0007114511003254. Epub 2011 Jul 18. Br J Nutr. 2012. PMID: 21767449 Clinical Trial.
A total of twenty-two healthy subjects (ten men and twelve women: age 23 (sem 1) years, BMI 22.1 (sem 0.5) kg/m2) received an isoenergetic high-protein (30/0/70 % of energy from protein/carbohydrate/fat) or normal-protein diet (12/55/33 % of energy from protein/carbohydrat …
A total of twenty-two healthy subjects (ten men and twelve women: age 23 (sem 1) years, BMI 22.1 (sem 0.5) kg/m2) received an isoener …
215 results